PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00037.1_g00036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family TALE
Protein Properties Length: 636aa    MW: 69935.2 Da    PI: 6.9016
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00037.1_g00036.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.82.1e-094344711954
                              HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                 Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                              Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Rsa1.0_00037.1_g00036.1 434 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 471
                              664559******************************88 PP

2BELL122.22.2e-39292363172
                     BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                              +r e+q++k+kLl++leeVd+rY++y+eq+q+v++sF++v+g+g+a pYt+lA+ka+SrhFrcLkda+a q+
  Rsa1.0_00037.1_g00036.1 292 DRIEHQRRKVKLLTMLEEVDRRYNHYCEQMQMVVNSFDIVMGHGAAIPYTALAQKAMSRHFRCLKDAVAAQL 363
                              589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-79218361IPR006563POX domain
PfamPF075263.9E-52223360IPR006563POX domain
PROSITE profilePS5007112.568412475IPR001356Homeobox domain
CDDcd000862.66E-12415476No hitNo description
SMARTSM003891.2E-9415479IPR001356Homeobox domain
SuperFamilySSF466892.74E-17416482IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.2E-29418481IPR009057Homeodomain-like
PfamPF059203.1E-18432471IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
MDEESSVPRS GIPVYEPAGM LSEMFNFHRS SGGGGGVDLD HSQSFRLNRQ LLEQQHQNIP  60
AINATDSAAA MRLFLMNPPP PQQPPSTRSH HGSSTLHMLL PNPSHHQGYT NTMSMHQLPH  120
QQLTWQPSSD HHNRQTEIGT VHVENSGGQG LSLSLSSSLE AAAKAEEYRK IYHGSNLSSH  180
HQFNEFKTLL ADSSQHHHHQ VSNQFLSSPA AASSSSSVGA VTILRNSRYT KAAQELLEEF  240
CSVGRGFSKK NKLKNNSNPN TSAGDGSSSG GGGGSPSSAG ASKEHPPLSA SDRIEHQRRK  300
VKLLTMLEEV DRRYNHYCEQ MQMVVNSFDI VMGHGAAIPY TALAQKAMSR HFRCLKDAVA  360
AQLRHSCELL GDKDAAGISS LGLTKGETPR LRLLEQSLRQ QRAFHQMGMM EQEAWRPQRG  420
LPERSVNILR AWLFEHFLHP YPSDADKHLL ARQTGLSRNQ VSNWFINARV RLWKPMVEEM  480
YQQESKEREE GLEENEQEDQ ETKNNDKSTK PNNNESNFTA VRTTTQTPTT AATPPDAGHR  540
LRSAADINAY ENDPSSSSYS NAAAVVSNYG GSAAFSAVAT CQQGVSGFDD ADMDGDNVIR  600
FGTNPTGDVS LTLGLRHAGN MPDENASFCV RDFGGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A9e-17421479563Homeobox protein Meis2
3k2a_B9e-17421479563Homeobox protein Meis2
4xrs_A7e-17421478158Homeobox protein Meis1
4xrs_B7e-17421478158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF1738160.0AF173816.1 Arabidopsis thaliana bel1-like homeodomain 2 (BLH2) mRNA, complete cds.
GenBankAY0504590.0AY050459.1 Arabidopsis thaliana AT4g36870/C7A10_490 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596914.10.0PREDICTED: BEL1-like homeodomain protein 2
SwissprotQ9SW800.0BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLA0A0D3A1F70.0A0A0D3A1F7_BRAOL; Uncharacterized protein
STRINGAT4G36870.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21662466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.20.0BEL1-like homeodomain 2